PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000323779
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family NAC
Protein Properties Length: 248aa    MW: 28589.9 Da    PI: 9.2328
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000323779genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM74.62.4e-2325970128
            NAM  70 tgkrknratksgyWkatgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                    +g r+nrat sgyWkatg+dk+++s +++ vg+kk Lvfy+gr pkg+k+dW+mheyrl
  MDP0000323779   2 NGIRPNRATVSGYWKATGTDKAIYS-ESKYVGVKKALVFYQGRPPKGVKSDWIMHEYRL 59 
                    789**********************.999****************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5100533.262187IPR003441NAC domain
SuperFamilySSF1019417.98E-29187IPR003441NAC domain
PfamPF023656.8E-10659IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 248 aa     Download sequence    Send to blast
PNGIRPNRAT VSGYWKATGT DKAIYSESKY VGVKKALVFY QGRPPKGVKS DWIMHEYRLG  60
DTRKQQANKQ LGSMRLDDWV LCRIYKKRQP GKAYLDPKVE EDEKIEMTTP ETAKANEEQM  120
MLKFPRTCSI TSLLDMDYLG PMSQLLGDNN SGYDFQSSLA GAELXXXXXX XXXXXXXXXX  180
XXXXXXXXXX XXXXXXXXXX XXXXXXXXXX XXXXXXXXXX XXXXXXXXXX XXXXXXXXXX  240
XXXXXXVX
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A3e-3218884166NO APICAL MERISTEM PROTEIN
1ut4_B3e-3218884166NO APICAL MERISTEM PROTEIN
1ut7_A3e-3218884166NO APICAL MERISTEM PROTEIN
1ut7_B3e-3218884166NO APICAL MERISTEM PROTEIN
3swm_A3e-3218887169NAC domain-containing protein 19
3swm_B3e-3218887169NAC domain-containing protein 19
3swm_C3e-3218887169NAC domain-containing protein 19
3swm_D3e-3218887169NAC domain-containing protein 19
3swp_A3e-3218887169NAC domain-containing protein 19
3swp_B3e-3218887169NAC domain-containing protein 19
3swp_C3e-3218887169NAC domain-containing protein 19
3swp_D3e-3218887169NAC domain-containing protein 19
4dul_A3e-3218884166NAC domain-containing protein 19
4dul_B3e-3218884166NAC domain-containing protein 19
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Mdo.98590.0fruit| leaf| stem
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKF1981270.0KF198127.1 Malus hupehensis NAC domain protein (NAC120) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008361781.11e-116PREDICTED: NAC transcription factor 29-like
SwissprotO492552e-60NAC29_ARATH; NAC transcription factor 29
TrEMBLD9ZJA91e-116D9ZJA9_MALDO; NAC domain class transcription factor
STRINGGLYMA01G06150.12e-66(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF41033262
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69490.19e-62NAC-like, activated by AP3/PI